DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG43335

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:289 Identity:90/289 - (31%)
Similarity:130/289 - (44%) Gaps:64/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IENAPIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAA 117
            |...|..::|         .||||..|.....|..|.|     ..|..:||.||||:::.|||||
  Fly    31 IRTMPSFHRT---------RIIGGSDAEITSHPWMAYL-----YNEFHYFCAGTLITNQFVLTAA 81

  Fly   118 HCHYSPQGSVNI-ARLGDLEFDTNNDDA----DPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRP 177
            ||   .:.|.|: .|||.... |.:|.:    ..||:.|.....|..|:...:.|||:::||:|.
  Fly    82 HC---IEASKNLTVRLGGSGL-TRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLART 142

  Fly   178 VTFNDYKHPACLPFDDG-RL----GTSFIAIGWG---------QLEIVPRTENKKLQKVKLYNYG 228
            |.|.|:..|.|:..|.. ||    |.:.:|.|||         .|:..|.|...:....|||:..
  Fly   143 VKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVCSKLYDVA 207

  Fly   229 TRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGP---VLIYHMDYPCMYHVMGITSIG 290
                        :.:|     |:|.|..| .:||.||||||   |:.|:.|...:.:  ||||.|
  Fly   208 ------------ITQG-----QICAGDKE-TNTCLGDSGGPLGGVVNYYGDLRFVQY--GITSFG 252

  Fly   291 -VACDTPDLPAMYTRVHFYLDWIKQQLAK 318
             :.|.:   |::||.:..|..||...:::
  Fly   253 DIECRS---PSIYTDLSTYSGWINMVVSQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 87/264 (33%)
Tryp_SPc 73..312 CDD:214473 85/261 (33%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 85/262 (32%)
Tryp_SPc 42..275 CDD:238113 87/264 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.