DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and LOC101886682

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_005170582.2 Gene:LOC101886682 / 101886682 -ID:- Length:252 Species:Danio rerio


Alignment Length:247 Identity:64/247 - (25%)
Similarity:103/247 - (41%) Gaps:39/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLE---- 136
            |..|.|...|:...|....::     .|||:|||...|||||||.........:....||.    
Zfish    30 GTEAKPHSRPYMVSLQINSQH-----ICGGSLISKEFVLTAAHCWDKDDVLTVVTGAHDLRKKAI 89

  Fly   137 FDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLP--FDDGRLGTS 199
            ::|         |.|..:..||:::...:.|||.:::|...|..::......||  .:|.:..|.
Zfish    90 YNT---------FKVTSYIPHPDYNSYTLENDIMLLKLKTKVRLSNSVGLISLPRNGEDLKADTL 145

  Fly   200 FIAIGWGQL-EIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQLCIGSNEHKDTCN 263
            ....|||:| ....:|:..:..:..:.|       .|:........|.|:..:|  :..|..||:
Zfish   146 CSIAGWGRLWRKGAKTDRLREAETVIVN-------DAECERRWESDYVASKMIC--AYGHGGTCS 201

  Fly   264 GDSGGPVLIYHMDYPCMYHVMGITSIG--VACDTPDLPAMYTRVHFYLDWIK 313
            ||||||::       |....:|||:..  ..|.:...|.::.|:..||.||:
Zfish   202 GDSGGPLV-------CNNTAVGITAFSDRYLCKSRLFPDVFARISAYLPWIQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 64/247 (26%)
Tryp_SPc 73..312 CDD:214473 62/244 (25%)
LOC101886682XP_005170582.2 Tryp_SPc 27..248 CDD:238113 64/247 (26%)
Tryp_SPc 27..245 CDD:214473 62/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.