DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG42694

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:244 Identity:56/244 - (22%)
Similarity:98/244 - (40%) Gaps:46/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDADPEDF 149
            |.|..|.|......|  .|.|:|||.:.||:||.|       :::.....::...:|....|..:
  Fly    42 PQAGWLAHISNGTHV--LCSGSLISKQFVLSAAQC-------IDVHGKLFVQLGVSNATKSPHWY 97

  Fly   150 DVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLG-----TSFIAIGWGQLE 209
            .|.:... |..|...:..||.:::||:.|.:||:.:|.|:..:...|.     .:|....|    
  Fly    98 TVSNVVI-PSHSGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAW---- 157

  Fly   210 IVPRTENKKLQKVKLYNYG-TRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSG------ 267
               .::||..|.:.|.... .||::....| ..|:      ::|..|.:..::|..|||      
  Fly   158 ---LSKNKNPQTIVLSQLSRDRCKLNLSGN-VTPK------EICAASLQRNNSCFIDSGSALTQP 212

  Fly   268 ---GPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIK 313
               |..::..|    ::.:.|..:....|..   ||:|..|...:.||:
  Fly   213 IIQGSNIVREM----LFGIRGYVNGRSWCSE---PAIYIDVAECVGWIE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 56/244 (23%)
Tryp_SPc 73..312 CDD:214473 54/241 (22%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 54/240 (23%)
Tryp_SPc 46..253 CDD:214473 52/237 (22%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437617
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.