DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and XB5962685

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_002941155.3 Gene:XB5962685 / 100496550 XenbaseID:XB-GENE-5962686 Length:251 Species:Xenopus tropicalis


Alignment Length:280 Identity:76/280 - (27%)
Similarity:114/280 - (40%) Gaps:59/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LIENAPIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAAR---LGHKDENGEVEWFCGGTLISDRHV 113
            |:.|.||       |....  |.||..|:    |||.|   |.....|     .||||||.|..|
 Frog    11 LLLNTPI-------CAGMG--ITGGKEAI----PHARRYMALVRTGSN-----LCGGTLIKDNWV 57

  Fly   114 LTAAHCHYSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPV 178
            ||||.|......:|:   ||.....|.|...  :.|.|..:..|.:|...:..|::.:::||...
 Frog    58 LTAATCKVDRTTTVD---LGVHSIKTMNKLR--QQFKVARWVPHQKFDRRSYVNNLQLLQLSSKA 117

  Fly   179 TFNDYKHPACLP--FDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKL---------YNYGTRCR 232
            .|:...:...||  :.|.:.||.....|||......:.::.||.:|.|         ..:.::.:
 Frog   118 NFSYAVNILLLPTKYKDIKPGTVCETAGWGITAYNGKQQSDKLMEVSLTVLDRMQCNNQWKSKIK 182

  Fly   233 ITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIG-VACDTP 296
            ||.|             .:|......:..||||.|||::       |...:.|:.|.| :.|...
 Frog   183 ITKD-------------MMCTRDKGKRGFCNGDGGGPLI-------CNRILTGVISFGPLICGME 227

  Fly   297 DLPAMYTRV-HFYLDWIKQQ 315
            :...:|||: ..|:.|||::
 Frog   228 NGANVYTRLTSNYIKWIKKE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 71/257 (28%)
Tryp_SPc 73..312 CDD:214473 68/254 (27%)
XB5962685XP_002941155.3 Tryp_SPc 23..246 CDD:238113 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.