DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and si:dkey-78l4.13

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_003201101.3 Gene:si:dkey-78l4.13 / 100034660 ZFINID:ZDB-GENE-060503-459 Length:253 Species:Danio rerio


Alignment Length:284 Identity:76/284 - (26%)
Similarity:119/284 - (41%) Gaps:63/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FSFLIENAPIIYKTLDKCTSYAPL---IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISD 110
            ||.|:    ::| .|...|..|.:   |:.|..|.|...|:...:....::     .|||.|:|:
Zfish     3 FSVLL----LVY-LLPNLTLQASVKSGIVNGNEARPHSRPYMVSVQCNRKH-----ICGGFLVSE 57

  Fly   111 RHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLS 175
            :.|:|||||..:  |......:|..|:   .|.|  ...|||.:..||.|....:.|||.:::|.
Zfish    58 QFVMTAAHCFVN--GKELTVVVGAHEY---TDGA--SRMDVKFYHIHPGFESKTLLNDIMLLQLH 115

  Fly   176 RPVTFNDYKHPACLPFDDG--RLGTSFIAIGWGQ-----------LEI-VPRTENKKLQKVKLYN 226
            :.|..::..:...:|..|.  :..|.....|||:           :|: |...:.|..||.    
Zfish   116 KKVKKSNKVNWIPIPNADKDIKAKTKCSVAGWGKNTTHGEVSAKLMEVNVTLFDKKACQKY---- 176

  Fly   227 YGTRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGV 291
            :|..              |:.:..:|.|.  |...|.||||||::       |....:||.|...
Zfish   177 WGPT--------------YSTSKMMCTGG--HGGFCQGDSGGPLV-------CDKVAVGIVSFNE 218

  Fly   292 A--CDTPDLPAMYTRVHFYLDWIK 313
            .  ||:|..|.:||::..:|.|||
Zfish   219 KNNCDSPTKPNVYTQISKFLSWIK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 69/257 (27%)
Tryp_SPc 73..312 CDD:214473 66/254 (26%)
si:dkey-78l4.13XP_003201101.3 Tryp_SPc 25..242 CDD:238113 67/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.