DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and gzma

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:258 Identity:68/258 - (26%)
Similarity:102/258 - (39%) Gaps:64/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LGHRKTNNEIKWF----------CGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDA 143
            :|.:.....:.|.          |||.||....|||||||....:..|.|: :|.|....     
Zfish    29 VGGKDVKKALSWMVSIQVNQNHKCGGILIHKEWVLTAAHCKEDSYSSVTVL-IGSLSLSK----- 87

  Fly   144 EPEDFGVLALKAHPGFENPQLYN------DIGIVQLDREVKFNRYKHPACLPFDDGEQHESFIAI 202
                 |...:..| .:|.|:.:|      ||.:::|.::||...||.|.  ...|.:.....:..
Zfish    88 -----GSQRIAIH-NYEIPETFNKKTKKDDIMLIRLSKKVKAKPYKIPK--KEKDVQPGTKCVVR 144

  Fly   203 GWGQKKFAQKESKKLL---------KVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIG-SRDNK 257
            |||...:..|::...|         :||...|.:|            |....|..||.| ::.::
Zfish   145 GWGTTDYKGKQASDKLQMLEVLVVDRVQCNRYYNR------------NPVITKDMLCAGNTQQHR 197

  Fly   258 DTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYT---RVHYFLNWIKGELAKQ 317
            .||.||||||       |.|..:::|:.|....|..|..|:.||   :.|  :.||...|.:|
Zfish   198 GTCLGDSGGP-------LECEKNLVGVLSGSHGCGDPKKPTVYTLLSKRH--ITWINKILKQQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 65/250 (26%)
Tryp_SPc 72..310 CDD:214473 64/249 (26%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 66/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.