DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and TMPRSS3

DIOPT Version :10

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:77 Identity:19/77 - (24%)
Similarity:27/77 - (35%) Gaps:23/77 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VNEFLLNC--STNRPQVTPVCGLISPVCEHCHRRIDAFDENAPPKVIEYVIKTDLDPEPLDYDPL 76
            :.|::|:.  ..:||:||                ||.........||.....||.|.|.:.|...
Human   114 IQEYVLHVYKHLSRPKVT----------------IDRQSNKNGTCVINLTCSTDQDGENVTYSWK 162

  Fly    77 NVGDMSDPMGDD 88
            .||     .||:
Human   163 AVG-----QGDN 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 5/17 (29%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:464747 19/77 (25%)
Tryp_SPc 216..444 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.