DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG18754

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:288 Identity:78/288 - (27%)
Similarity:108/288 - (37%) Gaps:79/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SCHGSRPLIVD--GTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRL-----VLTAAHCFFS 121
            :|..:.|:..|  ...||..|:|:...|                |..|||     |||||||...
  Fly    96 TCGQTTPVFRDRGAENAELNEYPWMVLL----------------LYENRLSLIRYVLTAAHCVIG 144

  Fly   122 EHGEVN-----VVRLGELEFDTDTDDAE-PE-DFGVLALKAHPGFENP--QLYNDIGIVQLDREV 177
            .:...|     .|||||...|..|.::. |. |..|.....|.||.:.  ...|||.:::|...|
  Fly   145 GYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPV 209

  Fly   178 KFNRYKHPACL-----PFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDAND 237
            ::.:...|.||     |..|.....|    ||...|.:|......:|.:         :..|..:
  Fly   210 RYTKKIQPICLLDAEFPLQDLNLQIS----GWDPTKSSQTLITSTVKER---------NPADCLN 261

  Fly   238 ELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGIT------------ 290
            ..|: :...||:|.|.:...|||.|.||.|             ||||..:|:.            
  Fly   262 RYPS-FRSASQVCAGGQRKGDTCAGISGSP-------------VMGIMGSGVDEFVFLAGIASYG 312

  Fly   291 ---CSTPDIPSAYTRVHYFLNWIKGELA 315
               |.:..||..||::.:|..|||..||
  Fly   313 QQYCYSAGIPGVYTKIGHFSEWIKANLA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 72/274 (26%)
Tryp_SPc 72..310 CDD:214473 71/273 (26%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 73/272 (27%)
Tryp_SPc 108..335 CDD:214473 70/269 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.