DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and F12

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_067464.2 Gene:F12 / 58992 MGIID:1891012 Length:597 Species:Mus musculus


Alignment Length:260 Identity:80/260 - (30%)
Similarity:116/260 - (44%) Gaps:34/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARL--GHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHG--EVNVVRLG 132
            :|.|..|.|...|:.|.|  |    ||    ||.|:||:...|||||||..:...  |:.|| ||
Mouse   355 VVGGLVALPGSHPYIAALYWG----NN----FCAGSLIAPCWVLTAAHCLQNRPAPEELTVV-LG 410

  Fly   133 ELEFDTDTDDAE-PEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNR------YKHPACLPF 190
            :   |......| .:...|.:.:.|.||.:....:|:.:::| :|.|.|.      :..|.|||.
Mouse   411 Q---DRHNQSCEWCQTLAVRSYRLHEGFSSITYQHDLALLRL-QESKTNSCAILSPHVQPVCLPS 471

  Fly   191 DDGEQHESFI--AIGWG-QKKFAQKESKKLLKVQLQGYK-DRCVSSVDANDELPNGYEPKSQLCI 251
            ......|:.:  ..||| |.:.|::.|..|.:.|:.... |||.:|....|.:..|     .||.
Mouse   472 GAAPPSETVLCEVAGWGHQFEGAEEYSTFLQEAQVPFIALDRCSNSNVHGDAILPG-----MLCA 531

  Fly   252 GSRD-NKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIKGELA 315
            |..: ..|.|.||||||::...........:.|:.|.|..|...:.|..||.|..:|.||:..:|
Mouse   532 GFLEGGTDACQGDSGGPLVCEEGTAEHQLTLRGVISWGSGCGDRNKPGVYTDVANYLAWIQKHIA 596

  Fly   316  315
            Mouse   597  596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 78/254 (31%)
Tryp_SPc 72..310 CDD:214473 77/253 (30%)
F12NP_067464.2 FN2 41..88 CDD:238019
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:278437
KR 217..295 CDD:294073
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..338
Tryp_SPc 354..591 CDD:214473 77/253 (30%)
Tryp_SPc 355..594 CDD:238113 79/256 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.