DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG34171

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:229 Identity:65/229 - (28%)
Similarity:107/229 - (46%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 FCGGTLISNRLVLTAAHCFFSEHGEVN-----VVRLGELEFDTDTDDAEPEDF--GVLALKAHPG 158
            ||.|.:::||.|||:|||...::|.:.     ||.|....|.|    .|.|:|  .:..:..||.
  Fly    56 FCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKT----PESEEFVVDIHNMIIHPY 116

  Fly   159 FENPQLYNDIGIVQLDREVKFN-RYKHPACL---PFDDGEQHESFIAI-GWGQKKFAQKESKKLL 218
            :...| :|||.|::|.|.||.: .:..|..|   ..:.|...::...| |..:::|....|..|:
  Fly   117 YHRNQ-HNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLV 180

  Fly   219 KVQLQGYKDRC-------VSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLA 276
            .|:|:.: |.|       :::...|::|         :|:.|.: |..|..|.|||       |.
  Fly   181 NVELRPF-DECLKVKKSLMAARPENEDL---------ICVKSTE-KQMCTTDFGGP-------LF 227

  Fly   277 CMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWI 310
            |...:.||....|.||:|| |..::.|.::.:|:
  Fly   228 CDGQLYGIALGSINCSSPD-PVFFSDVSFYNSWV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 65/229 (28%)
Tryp_SPc 72..310 CDD:214473 64/227 (28%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 64/227 (28%)
Tryp_SPc 38..263 CDD:304450 65/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.