DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and LOC4577519

DIOPT Version :10

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_061513842.1 Gene:LOC4577519 / 4577519 VectorBaseID:AGAMI1_007013 Length:63 Species:Anopheles gambiae


Alignment Length:47 Identity:19/47 - (40%)
Similarity:26/47 - (55%) Gaps:0/47 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHC 118
            :..|..|...||.....:|..:.:.:|.:.||||||..:.|||||||
Mosquito    11 VFGGFRALRDEFQHMVVIGWTRASGKIDYLCGGTLIIKQFVLTAAHC 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 19/47 (40%)
LOC4577519XP_061513842.1 None

Return to query results.
Submit another query.