DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:326 Identity:77/326 - (23%)
Similarity:134/326 - (41%) Gaps:86/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LELILLLVFSLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRP 70
            ::|.:.|..:::::..   .|.|..:|..|..|.:..:.|                         
  Fly     1 MKLFVFLALAVAAATA---IPTPEQKLVPTPVKDVKIQGR------------------------- 37

  Fly    71 LIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELE 135
             |.:|.||...:.|:...|......|   |:|||::|.|..|||||||   .:|...|.    :.
  Fly    38 -ITNGYPAYEGKVPYIVGLLFSGNGN---WWCGGSIIGNTWVLTAAHC---TNGASGVT----IN 91

  Fly   136 FDTDTDDAEPED---FGVLALKAHPGFENPQLYNDIGIVQLDREVKF----NRYKHPACLPFDDG 193
            :.....: :|:.   .|......|..:.:..|:|||.:::.. .|.|    |:.:.|:   ::|.
  Fly    92 YGASLRN-QPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTP-HVDFWHLVNKVELPS---YNDR 151

  Fly   194 EQHES---FIAIGWGQKKFAQKESKKL------LKVQLQGYKDRCVSSVDANDELPNGYEPKSQL 249
            .|..:   .:|.|||    ...:...|      :.||:....| |..|...:|.:         :
  Fly   152 YQDYAGWWAVASGWG----GTYDGSPLPDWLQAVDVQIMSQSD-CSRSWSLHDNM---------I 202

  Fly   250 CIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGIT----SAGITCSTPDIPSAYTRVHYFLNWI 310
            ||.:...|.||.||||||::.:..:     .::|:|    |||  |.: ..|:.::||..:|:||
  Fly   203 CINTNGGKSTCGGDSGGPLVTHEGN-----RLVGVTSFVSSAG--CQS-GAPAVFSRVTGYLDWI 259

  Fly   311 K 311
            :
  Fly   260 R 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 68/258 (26%)
Tryp_SPc 72..310 CDD:214473 67/257 (26%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 68/284 (24%)
Tryp_SPc 38..262 CDD:238113 69/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.