DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG9737

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:335 Identity:95/335 - (28%)
Similarity:141/335 - (42%) Gaps:82/335 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KFKQIVFEERVAISFFFTDAPITYETVDSCHGSRPL----------IVDGTPAEPKEFPFAARLG 90
            :||:...:.|:             :||:...|...|          |..|..||..|||:.|.|.
  Fly   117 RFKRKKLKRRI-------------QTVEPSSGFNLLNECGKQVTNRIYGGEIAELDEFPWLALLV 168

  Fly    91 HRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGE-------VNVVRLGELEFDTDTDDAEPE-- 146
            :    |...:.|.|.||.:|.:||||||.   .||       :..|||||....|:.|..|..  
  Fly   169 Y----NSNDYGCSGALIDDRHILTAAHCV---QGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNY 226

  Fly   147 --------DFGVLALKAHPGFE--NPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGE-----QH 196
                    |.....:..||.::  :...||||.|::|...|.|..:..|.||| :..|     :.
  Fly   227 LSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLP-NKSEPLTLAEG 290

  Fly   197 ESFIAIGWGQ-----KKFAQKESKKLLKVQLQGY--KDRCVSSVDANDELPNGY----EPKSQLC 250
            :.|...|||:     |.|....|...||:::. |  .:.|...::       |:    .|| |:|
  Fly   291 QMFSVSGWGRTDLFNKYFINIHSPIKLKLRIP-YVSNENCTKILE-------GFGVRLGPK-QIC 346

  Fly   251 IGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGIT-CSTPDIPSAYTRVHYFLNWI---- 310
            .|....||||.||||||::.:.:..: .:...|:.|.|.| |.....|:.||.|..:.:||    
  Fly   347 AGGEFAKDTCAGDSGGPLMYFDRQHS-RWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVV 410

  Fly   311 -KGELAKQTQ 319
             :.:.::|||
  Fly   411 QQRKKSQQTQ 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 85/279 (30%)
Tryp_SPc 72..310 CDD:214473 83/273 (30%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 83/274 (30%)
Tryp_SPc 150..409 CDD:238113 85/276 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.