DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:321 Identity:75/321 - (23%)
Similarity:128/321 - (39%) Gaps:78/321 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LELILLLVFSLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRP 70
            ::|.:.|..:::::...   |.|..:|..|..|.|                            :.
  Fly     1 MKLFVFLALAVAAATAV---PAPAQKLTPTPIKDI----------------------------QG 34

  Fly    71 LIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELE 135
            .|.:|.||...:.|:...|......|   |:|||::|.|..|||||||.....|.  .:..|.  
  Fly    35 RITNGYPAYEGKVPYIVGLLFSGNGN---WWCGGSIIGNTWVLTAAHCTNGASGV--TINYGA-- 92

  Fly   136 FDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKF----NRYKHPACLPFDDGEQH 196
             ...|........|...:..|..:.:..|:|||.:::.. .|.|    |:.:.|:   ::|..|.
  Fly    93 -SIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTP-HVDFWSLVNKVELPS---YNDRYQD 152

  Fly   197 ES---FIAIGWGQKKFAQKESKKL------LKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIG 252
            .:   .:|.|||    ...:...|      :.||:....| |..:...:|.:         :||.
  Fly   153 YAGWWAVASGWG----GTYDGSPLPDWLQSVDVQIISQSD-CSRTWSLHDNM---------ICIN 203

  Fly   253 SRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGIT--CSTPDIPSAYTRVHYFLNWIK 311
            :...|.||.||||||::.:..:     .::|:||.|..  |.: ..|:.::||..:|:||:
  Fly   204 TDGGKSTCGGDSGGPLVTHDGN-----RLVGVTSFGSAAGCQS-GAPAVFSRVTGYLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 66/253 (26%)
Tryp_SPc 72..310 CDD:214473 65/252 (26%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 67/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.