DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG4815

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:235 Identity:63/235 - (26%)
Similarity:95/235 - (40%) Gaps:51/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NEIKWFCGGTLISNRLVLTAAHCFFS-EHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGF 159
            |..|..|..||::.|.:|||||||.: ...:.:|:.....||....::.....  ::.::.||.:
  Fly    55 NGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKNK--LIRVQIHPKY 117

  Fly   160 ENPQLYND--------------IGIVQLDREVKFNRYKHPACLPFDDGEQHESFIAIGWGQKKFA 210
            ...:...|              ||..||.|.|     .||          .:..||.|||.:...
  Fly   118 AKMKFIADVAVAKTKYPLRSKYIGYAQLCRSV-----LHP----------RDKLIAAGWGFEGGV 167

  Fly   211 QKESKK----LLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAY 271
            ..||:|    .:||.:...:| |...:|..       .|.:.:|.|:.:||..|.||||||:|..
  Fly   168 WDESRKKTFRSMKVGIVSKRD-CEKQLDRK-------MPPNIICAGAYNNKTLCFGDSGGPLLLG 224

  Fly   272 HKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIK 311
            .:       |.||.:....|...:.|..|..|.|:..:||
  Fly   225 RQ-------VCGINTWTFKCGNNEKPDVYMGVRYYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 61/233 (26%)
Tryp_SPc 72..310 CDD:214473 61/232 (26%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 63/235 (27%)
Trypsin 49..256 CDD:278516 61/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.