DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG10232

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:279 Identity:86/279 - (30%)
Similarity:127/279 - (45%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SCHGSRPL--IVDGTPAEPKEFPFAARLGHRK------TNNEIKWFCGGTLISNRLVLTAAHCFF 120
            ||..:.||  :..||.|.|.|:|:.|.|.:..      |||     |.|:||:.|.|||||||..
  Fly   247 SCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNN-----CSGSLINKRYVLTAAHCVV 306

  Fly   121 SEHGEVNV------VRLGELEFDTDTD------DAEP-EDFGVLALKAHPGFENPQLY-NDIGIV 171
            .:. .||.      |||||.:..|:.|      .|.| .:.|:.....|..:.|...: :||.:|
  Fly   307 KDK-MVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALV 370

  Fly   172 QLDREVKFNRYKHPACLPFDDGEQHESFIAI-GWGQKKFAQKESKKLLKVQLQG--YKDR--CVS 231
            :|...|::.....|.|:|.|....|...:.| |||..|     :::..:|.|..  |::|  |..
  Fly   371 RLQTPVRYTHEILPICVPKDPIPLHNHPLQIAGWGYTK-----NREYSQVLLHNTVYENRYYCQD 430

  Fly   232 SVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGP-VLAYHKDLACMYHVMGITSAGITCSTPD 295
            .:       :.:..:||:|......:|:|.|||||| :|..:.|...:.::.||.|.|.......
  Fly   431 KI-------SFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDR 488

  Fly   296 IPSAYTRVHYFLNWIKGEL 314
            .|..||:...|.:|||..|
  Fly   489 KPGVYTKTGAFFSWIKANL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 79/264 (30%)
Tryp_SPc 72..310 CDD:214473 78/263 (30%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 81/263 (31%)
Tryp_SPc 260..503 CDD:214473 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437540
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.