DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and SPE

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:278 Identity:90/278 - (32%)
Similarity:132/278 - (47%) Gaps:49/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWF-CGGTLISNRLVLTAAHCFFS----EHGEV-NVVR 130
            |..||.....|||:...|.::|..:|...| |||.|:::|.||||.||..|    :.|.| :.||
  Fly   135 IFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVR 199

  Fly   131 LGELEFDTDTD----------------DAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKF 179
            |||.:..||.|                |.|.|. |::.....|...:.:  |||.:|:|.|.|.:
  Fly   200 LGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEK-GIIHEMYAPNSVDQR--NDIALVRLKRIVSY 261

  Fly   180 NRYKHPACLPFDDGEQHESFI-----AIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDEL 239
            ..|..|.||| .||....:|:     ..|||..:..|..:.| ||:.:.      |.::.:..|.
  Fly   262 TDYVRPICLP-TDGLVQNNFVDYGMDVAGWGLTENMQPSAIK-LKITVN------VWNLTSCQEK 318

  Fly   240 PNGYEPK---SQLCIGSRDNKDTCNGDSGGPVL----AYHKDLACMYHVMGITSAGI-TCSTPDI 296
            .:.::.|   ||:|.|.:...|||.||||||::    ...:|   ::::.|:||.|. .|.....
  Fly   319 YSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRD---VFYIAGVTSYGTKPCGLKGW 380

  Fly   297 PSAYTRVHYFLNWIKGEL 314
            |..|||...|::|||.:|
  Fly   381 PGVYTRTGAFIDWIKQKL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 87/273 (32%)
Tryp_SPc 72..310 CDD:214473 86/272 (32%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 89/275 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.