DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG16710

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:270 Identity:87/270 - (32%)
Similarity:124/270 - (45%) Gaps:44/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARL--GHRKT---NNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRL 131
            |..|...:|.|.|:.|.:  .||..   |..:...|.|:||:||.|||||||......::..|||
  Fly   106 IFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVRL 170

  Fly   132 GELEFDTDTD---------DAEPEDFGV---LALKAHPGF----ENPQLYNDIGIVQLDREVKFN 180
            ||....::.|         ...||...:   |::| |..:    |.|  ||||.:::|...|::.
  Fly   171 GEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIK-HRHYMVFEERP--YNDIALLRLKFPVRYT 232

  Fly   181 RYKHPACLPFD------DGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYK-DRCVSSVDANDE 238
            ....|.|:..|      ....|:..|| ||| ....|..|..||:..:.|.. |.|..|     |
  Fly   233 AQIKPICVQLDYIFSNPSFSNHKLQIA-GWG-LSHKQGYSNVLLQAYVNGRNADECSLS-----E 290

  Fly   239 LPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHK--DLACMYHVMGITSAGIT-CSTPDIPSAY 300
            ...|.:.::.:|.|:....|||.||||||::|..:  |...:| :.||||.|.: |...  |:||
  Fly   291 PSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVY-LAGITSYGYSQCGYG--PAAY 352

  Fly   301 TRVHYFLNWI 310
            |:...|:.||
  Fly   353 TKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 87/270 (32%)
Tryp_SPc 72..310 CDD:214473 85/268 (32%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 85/268 (32%)
Tryp_SPc 106..362 CDD:238113 85/268 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.