DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG31199

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:275 Identity:61/275 - (22%)
Similarity:97/275 - (35%) Gaps:68/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DSCHG---SRPLIVDGTPAEPKEFPFAARL-------GHRKTNNEIKWFCGGTLISNRLVLTAAH 117
            |.|..   .:.|.:..|.|.|.|..:.||:       |..:.|.     |.|.|:|.|.||..||
  Fly    27 DQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKGFEGKIRDNG-----CLGVLVSKRTVLAPAH 86

  Fly   118 CFFSEHG--EVNVVRLGELE---------FDTDTDDAEP-EDFGVLALKAHPGFENPQLYNDIGI 170
            ||...:|  |...|.||...         .:||.....| ::..:..:..||.:::..|.|.:.:
  Fly    87 CFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLAV 151

  Fly   171 VQLDREVKFNRYKHPACLPFDDGEQHESFIA---IGWGQKKFAQKESKKLLKVQLQGYKDRCVSS 232
            :.|.|:.|......|.|:| .....:|:.:|   :..|.:.|.....|..:....:|:   |.|.
  Fly   152 LTLQRDAKIYPNVMPICMP-PPSLLNETLVAQTFVVAGLRVFEDFRLKTWVNTLSRGF---CQSK 212

  Fly   233 VDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMY---HVMGITSAGITCSTP 294
            |            |:.:             .|...|..|||.....|   .::|:...|      
  Fly   213 V------------KTLV-------------TSSNTVCGYHKQPVAYYLGAPLVGLQKKG------ 246

  Fly   295 DIPSAYTRVHYFLNW 309
            .:...|..|...::|
  Fly   247 HVTQNYYLVGIMIDW 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 58/263 (22%)
Tryp_SPc 72..310 CDD:214473 58/263 (22%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 56/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.