DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG31219

DIOPT Version :10

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:280 Identity:89/280 - (31%)
Similarity:127/280 - (45%) Gaps:62/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNN-EIKWFCGGTLISNRLVLTAAHCFFSEHGEVNV--VRLGE 133
            :|.|:.|.|..:|:.|.|.:..|.. ||..||.|:||:||.|||:|||......::::  |||||
  Fly    89 MVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGE 153

  Fly   134 LEF-----------DTDTDDAEPEDFGVLALK-----AHPGF---ENPQLYNDIGIVQLDREVKF 179
            .:.           |.|...|.|.    |.:|     .|..|   .|..:..||.:::|...|::
  Fly   154 HDITYDPAYNPDCRDQDNQCALPN----LEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRY 214

  Fly   180 NRYKHPACLPFDDGEQHESF------IAIGWGQKKFAQKESKKLLKVQLQGY-KDRCVS------ 231
            .....|.|:|     :|..|      || |||:....|     ..:|.:.|: ::|.::      
  Fly   215 RTGIMPICIP-----KHGFFAKSKLEIA-GWGKTNEGQ-----FSQVLMHGFIRERSIAVCALRF 268

  Fly   232 -SVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGI-TCSTP 294
             .:|.|..|        |:|.|..|..|||.||||||::. ..|.:.:| :.|||:.|. .|...
  Fly   269 PYLDLNQSL--------QICAGGYDGVDTCQGDSGGPLMV-TMDNSSVY-LAGITTYGSKNCGQI 323

  Fly   295 DIPSAYTRVHYFLNWIKGEL 314
            .||..|||...||.|||..|
  Fly   324 GIPGIYTRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 86/275 (31%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 85/274 (31%)

Return to query results.
Submit another query.