DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG31265

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:224 Identity:60/224 - (26%)
Similarity:103/224 - (45%) Gaps:37/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 CGGTLISNRLVLTAAHC---FFSEHGEVNVVRLGELEFDTDTDD-AEPEDFGVLALKA----HPG 158
            |||.:::...::||.||   |..  ..|||:        |.|:. |||   |.:...|    |..
  Fly    63 CGGAILNENWIITAGHCVENFIP--ALVNVI--------TGTNKWAEP---GAIYYTAEIHKHCM 114

  Fly   159 FENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQ 223
            ::.|.::|||.:|:|...:.||....|..||....:..|..:..|||.........:.|.|:.: 
  Fly   115 YDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGEEIVLTGWGSDVAYGSSMEDLHKLTV- 178

  Fly   224 GY--KDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITS 286
            |.  .|.|..:.:....:..|:     :|..||:.:..|:||||||:::..:       ::|:.:
  Fly   179 GLVPLDECYETFNRTSSMGVGH-----ICTFSREGEGACHGDSGGPLVSNGQ-------LVGVVN 231

  Fly   287 AGITCSTPDIPSAYTRVHYFLNWIKGELA 315
            .|..|.. .:|.....|:|:|:||:.:|:
  Fly   232 WGRPCGV-GLPDVQANVYYYLDWIRSKLS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 58/218 (27%)
Tryp_SPc 72..310 CDD:214473 57/217 (26%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 57/217 (26%)
Tryp_SPc 39..257 CDD:238113 59/220 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.