DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and modSP

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:286 Identity:63/286 - (22%)
Similarity:107/286 - (37%) Gaps:60/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GTPAEP-KEFPFAARLGHRKTNNEIKWF---------------CGGTLISNRLVLTAAHCFFSEH 123
            |..|.| |:|...   |:...|..:.|.               |||:|::..||:|||||.:.|.
  Fly   359 GQLATPIKQFSSG---GYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEG 420

  Fly   124 GEV----NVVRLGELEFDTDTDDAEPED--FGVLALKAHPGFE--NPQLYNDIGIVQLDREVKFN 180
            ..:    :..|:...:|..:..:..||:  ..|..::..||::  ....|.|:.::.||...:.:
  Fly   421 TRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELS 485

  Fly   181 RYKHPACLPFDDGEQHESFIAIGWGQKKFA--QKESKKLLKVQLQGYKDRCVSSVDANDELPNGY 243
            ....|.|:.|....:.||  .....|.|||  ..|:|..|:......|...|...:..|      
  Fly   486 HVIRPICVTFASFAEKES--VTDDVQGKFAGWNIENKHELQFVPAVSKSNSVCRRNLRD------ 542

  Fly   244 EPKSQLCIGSRDNKDTCNGDSGG------PVLAYHKDLACMYHVMGITSAGITCSTPDIPSA--- 299
            ....:.||.::.....|.|||||      |..|:.......:.:.|:.|        :.|:|   
  Fly   543 IQADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVIS--------NAPNADQC 599

  Fly   300 ------YTRVHYFLNWIKGELAKQTQ 319
                  .|.:.:|.:.|...:.:..:
  Fly   600 AHSLTVMTNIQHFEDMILNAMNRSVE 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 62/276 (22%)
Tryp_SPc 72..310 CDD:214473 62/275 (23%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 57/263 (22%)
Tryp_SPc 371..591 CDD:304450 52/230 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.