DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG3505

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:269 Identity:84/269 - (31%)
Similarity:127/269 - (47%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCF---FSEHGEVNVVRLGELEFD 137
            |....:|||:.|.:.:.:.|.|....|||.|||:|.|||||||.   .:.:.::..|||||.:..
  Fly   111 TDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTS 175

  Fly   138 TDTD----------DAEP--EDFGVLALKAHPGF---ENPQLYNDIGIVQLDREVKFNRYKHPAC 187
            |:.|          |..|  :|..:..|..||.:   :..|: |||.:|:|....|.|.:..|.|
  Fly   176 TNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQI-NDIALVRLASPAKLNDFVQPIC 239

  Fly   188 LP-----FDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPK- 246
            ||     .|:.|...:.:| ||      |..|.:.::   :||.  .:||:   :|....|..: 
  Fly   240 LPNKQLRADELEDLVTEVA-GW------QASSSQRMR---KGYV--TISSI---EECQRKYASQQ 289

  Fly   247 -----SQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAG-ITCSTPDIPSAYTRVHY 305
                 |:||  ...|...|.|::|||::.:..|   .|.:.|:.|.| :.|..||.|..||||..
  Fly   290 LRIQASKLC--GLTNSQECYGNAGGPLMLFKND---GYLLGGLVSFGPVPCPNPDWPDVYTRVAS 349

  Fly   306 FLNWIKGEL 314
            :::||...|
  Fly   350 YIDWIHDSL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 82/264 (31%)
Tryp_SPc 72..310 CDD:214473 81/263 (31%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 83/265 (31%)
Tryp_SPc 111..354 CDD:214473 81/263 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.