DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG3505

DIOPT Version :10

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:269 Identity:84/269 - (31%)
Similarity:127/269 - (47%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCF---FSEHGEVNVVRLGELEFD 137
            |....:|||:.|.:.:.:.|.|....|||.|||:|.|||||||.   .:.:.::..|||||.:..
  Fly   111 TDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTS 175

  Fly   138 TDTD----------DAEP--EDFGVLALKAHPGF---ENPQLYNDIGIVQLDREVKFNRYKHPAC 187
            |:.|          |..|  :|..:..|..||.:   :..|: |||.:|:|....|.|.:..|.|
  Fly   176 TNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQI-NDIALVRLASPAKLNDFVQPIC 239

  Fly   188 LP-----FDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPK- 246
            ||     .|:.|...:.:| ||      |..|.:.::   :||.  .:||:   :|....|..: 
  Fly   240 LPNKQLRADELEDLVTEVA-GW------QASSSQRMR---KGYV--TISSI---EECQRKYASQQ 289

  Fly   247 -----SQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAG-ITCSTPDIPSAYTRVHY 305
                 |:||  ...|...|.|::|||::.:..|   .|.:.|:.|.| :.|..||.|..||||..
  Fly   290 LRIQASKLC--GLTNSQECYGNAGGPLMLFKND---GYLLGGLVSFGPVPCPNPDWPDVYTRVAS 349

  Fly   306 FLNWIKGEL 314
            :::||...|
  Fly   350 YIDWIHDSL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 82/264 (31%)
CG3505NP_650380.2 CLIP 32..82 CDD:463440
Tryp_SPc 111..356 CDD:238113 83/265 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.