DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG31326

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:260 Identity:73/260 - (28%)
Similarity:118/260 - (45%) Gaps:28/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLG-E 133
            |||..|...:..:.|:...:..|:.:|...:.|||||||...||:|||||.:...::...||. .
  Fly   272 PLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVS 336

  Fly   134 LEFDTDTDDAEPEDFGVLALKAHPGFENPQLYN-DIGIVQLDREVKFNRYKHPACL-----PFDD 192
            |..:|....::.|..||..|..|..|:..|... |:.:|:||..|::..|..|.||     ..|.
  Fly   337 LGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDL 401

  Fly   193 GEQHESFIAIGWG--QKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSRD 255
            .:..:|::| |||  :......|..|:..:.:       ||..:...|||:.....|.|| ..:.
  Fly   402 PQGLKSYVA-GWGPDETGTGNTEVSKVTDLNI-------VSEANCALELPHVLVQPSSLC-AKKT 457

  Fly   256 NKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGI------TCSTPDIPSAYTRVHYFLNWIKGEL 314
            ....|..|.|||::...:|   ::.:.|:.|.|:      ||.... ||.:|.|...:.|::.::
  Fly   458 GAGPCASDGGGPLMLREQD---VWVLRGVISGGVINEKENTCELSK-PSVFTDVAKHIEWVRQKM 518

  Fly   315  314
              Fly   519  518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 71/253 (28%)
Tryp_SPc 72..310 CDD:214473 70/252 (28%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 70/252 (28%)
Tryp_SPc 277..514 CDD:214473 69/249 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.