DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG11670

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:317 Identity:92/317 - (29%)
Similarity:155/317 - (48%) Gaps:63/317 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VFSLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRPLIVDGTP 77
            :|..:.|.|.|:|.:..|:                          |.:..|..:| |.::.    
  Fly   144 IFLNTESKVDGENYNKTAE--------------------------TEDLHDDFNG-RSIVA---- 177

  Fly    78 AEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDD 142
              |.::|..|.||.|..|:||.:.|||:|||...|||||||..:.....::|::|:::......:
  Fly   178 --PGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELN 240

  Fly   143 AEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACL-PFDD---GEQHESFIAIG 203
            ..|:...|..:..||.:.....|:|||::||:|.|::..:..|..| |.:|   |:.|    .:|
  Fly   241 VAPQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPMNDIPYGKLH----TMG 301

  Fly   204 WGQKKFAQKESKKLLKVQLQGYK-DRCVSSVDANDELPNGYEPKSQLCIGSRD-NKDTCNGDSGG 266
            :|...|||.::..|.::.|.... ::|.||:.|::..|:|. ..||:|....: |:|||.|||||
  Fly   302 YGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGL-LTSQICAHDYEKNRDTCQGDSGG 365

  Fly   267 PV-------------LAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWI 310
            |:             ..:::     |:::||||.|..|.: ::|..||||..:::||
  Fly   366 PLQLNLERRRRRHTSRKHYR-----YYLVGITSYGAYCRS-ELPGVYTRVSSYIDWI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 82/258 (32%)
Tryp_SPc 72..310 CDD:214473 80/256 (31%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 84/263 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.