DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and MP1

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:279 Identity:87/279 - (31%)
Similarity:130/279 - (46%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCF--FSEHGEVNVV 129
            |.|  :|.|.....:|||:.|.:.:.|..|.....|||:||::|.|||||||.  .....|:..|
  Fly   135 GDR--VVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGV 197

  Fly   130 RLGELEFDTDTDDA----------EP-EDFGV---LALKAHPGFENPQLYNDIGIVQLDREVKFN 180
            ||||.:..|:.|..          || .|:.|   :....:||....|| |||.:::|..||:::
  Fly   198 RLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQL-NDIALLRLRDEVQYS 261

  Fly   181 RYKHPACLPFDDGEQHESF-----IAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELP 240
            .:..|.|||....:.:..|     :..|||     :.|:.....::|:...|...:|     |..
  Fly   262 DFILPVCLPTLASQHNNIFLGRKVVVAGWG-----RTETNFTSNIKLKAELDTVPTS-----ECN 316

  Fly   241 NGYEPK------SQLCIGSRDNKDTCNGDSGGPVLAYHKDLA---CMYHVMGITSAGIT-CSTPD 295
            ..|..:      .|:|.|..:..|:|.||||||:|.  :|.:   ..|::.|:.|.|.| |....
  Fly   317 QRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLL--EDYSNGNSNYYIAGVVSYGPTPCGLKG 379

  Fly   296 IPSAYTRVHYFLNWIKGEL 314
            .|..||||..:||||:..:
  Fly   380 WPGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 84/269 (31%)
Tryp_SPc 72..310 CDD:214473 83/268 (31%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 84/271 (31%)
Tryp_SPc 138..397 CDD:238113 85/271 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.