DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG18223

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:234 Identity:54/234 - (23%)
Similarity:98/234 - (41%) Gaps:51/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 FCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPG----FEN 161
            ||||.:||...:||:|||...:...|:..|:..:...|..           .||:..|    .|.
  Fly    78 FCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTN-----------RLKSRKGLSLNMEV 131

  Fly   162 PQLY----------NDIGIVQLDREVKFNRYKHPAC----LPFDDGEQHESFIAIGWGQKKFAQK 212
            .:::          |:|.::.|.:::..:   :|..    ||..|.|...::..:|||:......
  Fly   132 KKIFVPDKFTVFNTNNIALMMLAKKLPLD---NPLVGVINLPTADPEPGLNYTVLGWGRIFKGGP 193

  Fly   213 ESKKLLKVQLQGY-KDRCVSSVDANDELPNGYEPKSQLCIGSRDN---KDTCNGDSGGPVLAYHK 273
            .:..:|.:.::.. :|.|...|....|        ..:|.|:.:|   ::.|.||:|.|::....
  Fly   194 LASDILHIDVELLPRDICEKKVHIFKE--------EMMCAGNLNNTMDENPCAGDTGSPLIFNET 250

  Fly   274 DLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIKG 312
                   |.|:.|..:.|.:..:||.||.|:..::||.|
  Fly   251 -------VFGVVSYRVGCGSKTLPSIYTNVYMHMDWING 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 52/231 (23%)
Tryp_SPc 72..310 CDD:214473 51/230 (22%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 54/234 (23%)
Tryp_SPc 60..280 CDD:214473 51/230 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.