DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and Jon74E

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:328 Identity:90/328 - (27%)
Similarity:137/328 - (41%) Gaps:80/328 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LELILLLVFSLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRP 70
            :::..:|||.|  .||||::      ::|                           :|..||...
  Fly     1 MQISTILVFLL--ILVQGRS------ISC---------------------------LDMGHGIGG 30

  Fly    71 LIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEV------NVV 129
            .|..|..|...:||:...|...:.|:...| ||.:|||:|.:||||||.  |....      .|:
  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCW-CGASLISDRYLLTAAHCV--EKAVAITYYLGGVL 92

  Fly   130 RLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLP----- 189
            ||...:....|:   ||      :..||.:....|.|||.:|:|..:........|..||     
  Fly    93 RLAPRQLIRSTN---PE------VHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSS 148

  Fly   190 ---FDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGY---EPKSQ 248
               :|    :...||.|||:    ..:....:...|: |..|.|.|   |::....|   :| :.
  Fly   149 RNSYD----YVPAIASGWGR----MNDESTAISDNLR-YVYRFVES---NEDCEYSYANIKP-TN 200

  Fly   249 LCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCS-TPDIPSAYTRVHYFLNWIKG 312
            :|:.:...|.||.|||||| |.|...:.....::|:||.|.... |...||.:||:..:|:|| |
  Fly   201 ICMDTTGGKSTCTGDSGGP-LVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI-G 263

  Fly   313 ELA 315
            |::
  Fly   264 EVS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 75/256 (29%)
Tryp_SPc 72..310 CDD:214473 74/255 (29%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.