DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG18180

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:113/268 - (42%) Gaps:60/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVN---- 127
            |:...||:|.||...:.|:...|..|...:.......||:|:|..:||||||...::.|::    
  Fly    31 GAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGSN 95

  Fly   128 ---------VVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYK 183
                     .||              .::|     .:||.:.: |...|||:::.. .|.||...
  Fly    96 WGWNGAYRQTVR--------------RDNF-----ISHPDWPS-QGGRDIGLIRTP-HVDFNGLI 139

  Fly   184 HPACLPFDDGEQHESF-----IAIGWGQKKFAQKESKKLLKVQLQGYKDRCVS-SVDANDELPNG 242
            :...|| ...||::.:     :|.|||......      |...||     ||. .:.:|.|....
  Fly   140 NKIPLP-SMNEQNDRYQDTWCVACGWGGMDNGN------LADWLQ-----CVDVQIISNSECEQA 192

  Fly   243 Y--EPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHY 305
            |  ...:.:|....|.|..|.||||||::.:  |.|.:..|  ||.|.::|.  |.||.||||..
  Fly   193 YGSVASTDMCTRHADGKSVCGGDSGGPLVTH--DNARLVGV--ITFASVSCH--DGPSGYTRVSD 251

  Fly   306 FLNWIKGE 313
            :|.||:.:
  Fly   252 YLEWIRDQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 73/259 (28%)
Tryp_SPc 72..310 CDD:214473 72/258 (28%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 72/259 (28%)
Tryp_SPc 36..259 CDD:238113 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.