DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG3088

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:254 Identity:62/254 - (24%)
Similarity:106/254 - (41%) Gaps:51/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEV---NVVRLG 132
            :|.:|:||...:.|:...:...::|   .| |.||:|.:..:||:|.|.....|..   ...||.
  Fly    28 IITNGSPAYEGQAPYVVGMAFGQSN---IW-CSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLS 88

  Fly   133 ELEFDTDTDDAEPEDFGV-LALKAHP--GFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGE 194
            :.:|......:|...... |||...|  ||.|                :.||...|:..  :..:
  Fly    89 QAQFTVTVGTSEYVTGNQHLALVRVPRVGFSN----------------RVNRVALPSLR--NRSQ 135

  Fly   195 QHESFIA--IGWGQKKFAQKESKKLLKVQLQ-GYKDRCVS---SVDANDELPNGYEPKSQLCIGS 253
            ::|::.|  .|||...|:...:..|..|.|| ...:.|::   |...:|::         ||..:
  Fly   136 RYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQI---------LCTRT 191

  Fly   254 RDNKDTCNGDSGGPVLAYHKDLACMYHVMGITS--AGITCSTPDIPSAYTRVHYFLNWI 310
            ...:.||.||:|.|::......     |:||::  |...| |..:|:.:.|:...|:||
  Fly   192 PSGRSTCFGDAGSPLITKQDST-----VVGISAFVASNGC-TLGLPAGFARITSALDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 62/253 (25%)
Tryp_SPc 72..310 CDD:214473 60/251 (24%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 62/253 (25%)
Tryp_SPc 29..244 CDD:214473 60/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.