DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:274 Identity:63/274 - (22%)
Similarity:98/274 - (35%) Gaps:93/274 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCF----------------- 119
            |.:|.|||..:.|:...||...     .|:|||::|::..||||.||.                 
  Fly    40 ITNGYPAEEGKAPYTVGLGFSG-----GWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTN 99

  Fly   120 -----------FSEH--GEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIV 171
                       |.:|  .::.::|:..::|....:..|...:.             ..|||    
  Fly   100 AQFTHWVGNGNFIKHSSADIALIRIPHVDFWHMVNKVELPSYN-------------DRYND---- 147

  Fly   172 QLDREVKFNRYKHPACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDAN 236
                   :|.:...||               |||...........|..|.||         :..|
  Fly   148 -------YNEWWAVAC---------------GWGGTYDGSPLPDYLQCVDLQ---------IIHN 181

  Fly   237 DELPNGYEPKSQ--LCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGIT--CSTPDIP 297
            .|....|.....  ||:.:.|.|.||.||||||::.:...     .::|:|:.|..  |.: ..|
  Fly   182 SECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGT-----KLVGVTNFGSVAGCQS-GAP 240

  Fly   298 SAYTRVHYFLNWIK 311
            :.:.||.|.|:||:
  Fly   241 AGFQRVTYHLDWIR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 62/272 (23%)
Tryp_SPc 72..310 CDD:214473 61/271 (23%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 61/271 (23%)
Tryp_SPc 40..256 CDD:238113 63/274 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.