DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and sphinx2

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:285 Identity:68/285 - (23%)
Similarity:103/285 - (36%) Gaps:85/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TVDSCHGSR--PLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEH 123
            |...|..::  |.|..|..|:|....:...:.:.|:......|..||:|||:.:||..       
  Fly    13 TFSVCEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVK------- 70

  Fly   124 GEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYND-----------IGIV-----Q 172
             ||.:.:..|..|.:.              :|..|::..::|.:           |.:|     :
  Fly    71 -EVLIFKYIEAHFGSK--------------RAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQK 120

  Fly   173 LDREVKFNRYKHPACLPFDDGEQHESFI-----AIGWGQKKFAQKESKKLLKVQLQGYKDRCVS- 231
            .||  :.:|.:.||.     |.:.|.::     ..|||..|         .||:|..:. |||. 
  Fly   121 FDR--RMSRVRVPAY-----GARFERYVGNMTMVCGWGTDK---------RKVRLPTWM-RCVEV 168

  Fly   232 SVDANDELPNGYEPKS--QLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMG--ITSAGI--- 289
            .|..|.|....:.|..  ::|......|..|.||.||.|:           .||  .|..||   
  Fly   169 EVMNNTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVV-----------TMGPNPTFIGIIWL 222

  Fly   290 ---TCSTPDIPSAYTRVHYFLNWIK 311
               .||. ..||.:.||...:.|||
  Fly   223 MPTNCSI-GYPSVHIRVSDHIKWIK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 63/270 (23%)
Tryp_SPc 72..310 CDD:214473 62/269 (23%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 62/270 (23%)
Tryp_SPc 26..248 CDD:304450 65/272 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.