DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG10469

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:269 Identity:71/269 - (26%)
Similarity:117/269 - (43%) Gaps:61/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARL-----GHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEV--NVV 129
            |::||.|:.|:.|:...|     |.:...|    .||||::|||.::|||||.......:  .::
  Fly    24 IMNGTAAKAKQLPYQVGLLCYFEGSKDEPN----MCGGTILSNRWIITAAHCLQDPKSNLWKVLI 84

  Fly   130 RLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGE 194
            .:|:::...|.:......:.::    |..|:...:.|||.:::|.:::.||:|..||.||    .
  Fly    85 HVGKVKSFDDKEIVVNRSYTIV----HKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLP----S 141

  Fly   195 QHESF-----IAIGWGQKK---------------FAQKESKKLLKVQLQGYKDRCVSSVDANDEL 239
            ..:::     |..|||...               .:.||.::....||.|...:.|.        
  Fly   142 AKKTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVH-------- 198

  Fly   240 PNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGI--TCSTPDIPSAYTR 302
             ||:     :||.|:... .|.||||||::.......    ::||.|.|.  .|.. .:|...||
  Fly   199 -NGF-----ICIDSKKGL-PCRGDSGGPMVLDDGSRT----LVGIVSHGFDGECKL-KLPDVSTR 251

  Fly   303 VHYFLNWIK 311
            |..:|.|||
  Fly   252 VSSYLKWIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 69/267 (26%)
Tryp_SPc 72..310 CDD:214473 68/266 (26%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 68/266 (26%)
Tryp_SPc 24..260 CDD:238113 69/267 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.