DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG6592

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:260 Identity:81/260 - (31%)
Similarity:121/260 - (46%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEF 136
            |..|....|..||:  ::|......:..::|||:|||::.|:|||||.  :..:..:|.||..|.
  Fly   123 IFGGDVGNPHCFPY--QVGMLLQRPKGLYWCGGSLISDKHVITAAHCV--DMAKRALVFLGANEI 183

  Fly   137 DTDTDDAE------PEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQ 195
            ....:..:      .|:|.:     :|.:...:|.:||.||:|...|.||...||..||....| 
  Fly   184 KNAKEKGQVRLMVPSENFQI-----YPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYE- 242

  Fly   196 HESF-----IAIGWGQKKFAQKESKKLLK-VQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSR 254
            :.||     ||.|||:..........:|: ||||....|...|     ..|..|. .:.:|...|
  Fly   243 YRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKS-----NFPLSYR-GTNICTSGR 301

  Fly   255 DNKDTCNGDSGGPVLAYHKDLACMYH-----VMGITSAG-ITCSTPDIPSAYTRVHYFLNWIKGE 313
            :.:.|||||||||::...:      |     ::||||.| |.......|:|:|:|..:|:||..|
  Fly   302 NARSTCNGDSGGPLVLQRR------HSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDE 360

  Fly   314  313
              Fly   361  360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 79/256 (31%)
Tryp_SPc 72..310 CDD:214473 78/255 (31%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 78/255 (31%)
Tryp_SPc 123..359 CDD:238113 80/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.