DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:304 Identity:71/304 - (23%)
Similarity:115/304 - (37%) Gaps:100/304 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FEERVAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTL 106
            ||:.|    |:.|.|:...:::.      .|..|.||...:.|:...||..| |....| |||::
  Fly    18 FEKPV----FWKDVPVGKASIEG------RITMGYPAYEGKVPYIVGLGFSK-NGGGTW-CGGSI 70

  Fly   107 ISNRLVLTAAHCF----------------------------FSEH--GEVNVVRLGELEFDTDTD 141
            |.|..|:||.||.                            |.||  |:::::|...::|     
  Fly    71 IGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIEHGSGDISLIRTPHVDF----- 130

  Fly   142 DAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDR-EVKFNRYKHPACLPFDDGEQHESFIAIGWG 205
                                   ::.:..|:|.| :.::|.|            |....:..|||
  Fly   131 -----------------------WSLVNKVELPRYDDRYNNY------------QGWWALVSGWG 160

  Fly   206 QKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKS--QLCIGSRDNKDTCNGDSGGPV 268
            :.......|:.|..|.:|         :..|....|.|...|  .:||.:.:||.||:||||||:
  Fly   161 KTSDEGGVSEYLNCVDVQ---------IGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPL 216

  Fly   269 LAYHKDLACMYHVMGITSAGITCS-TPDIPSAYTRVHYFLNWIK 311
            :.:..:     ..:||.|.|.:.. ..:.|....||..:|:||:
  Fly   217 VIHDGN-----RQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 64/272 (24%)
Tryp_SPc 72..310 CDD:214473 63/271 (23%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 63/272 (23%)
Tryp_SPc 41..257 CDD:238113 64/271 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.