DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and yip7

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:251 Identity:71/251 - (28%)
Similarity:112/251 - (44%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNV-VRLGELE 135
            |.:|..|...:||:  ::|...:::...|:|||::|.|..|||||||   ..|..:| :..|.  
  Fly    40 ITNGKDAVAGQFPY--QVGLSFSSSAGSWWCGGSIIGNEWVLTAAHC---TDGAASVTIYYGA-- 97

  Fly   136 FDTDTDDAEPEDFGVLA---LKAHPGFENPQLYNDIGIVQLDREVKF----NRYKHPACLPFDDG 193
                |....||...|::   .:.|..:....:.|||.::|.. .|.|    |:...||.......
  Fly    98 ----TVRTSPEFTQVVSSSKFRQHESYLALTIRNDISLIQTS-SVSFSATVNKISLPAVSNSYST 157

  Fly   194 EQHESFIAIGWG-QKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSRDNK 257
            .:.::.:|.||| ....|...|:.|..|.|     ..:|:....:...:.......||:.:.:..
  Fly   158 YEGKTAVASGWGLTSDQATAVSRDLQYVDL-----TIISNSKCQETFGSLIVTSRVLCVDTTNKA 217

  Fly   258 DTCNGDSGGPVLAYHKDLACMYHVMGITSAGIT--CSTPDIPSAYTRVHYFLNWIK 311
            .||.||||||       ||....::|.||.|..  |.: ..|:|:||:.|:.:|||
  Fly   218 STCQGDSGGP-------LALDGVLIGATSFGSADGCES-GAPAAFTRITYYRDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 69/249 (28%)
Tryp_SPc 72..310 CDD:214473 68/248 (27%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 68/248 (27%)
Tryp_SPc 40..267 CDD:238113 71/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.