DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG15873

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:234 Identity:57/234 - (24%)
Similarity:92/234 - (39%) Gaps:42/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 HRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGE------VNVVRLGELEFDTDTDDAEPEDF- 148
            ||..|:    ||.|.|:|:|.|||||||....:..      :.|| .|.:   |.....:..|| 
  Fly    62 HRGDNH----FCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVV-FGHI---TRLAVYDESDFR 118

  Fly   149 GVLALKAHPGFENPQLYNDIGIVQLDREVKFNRY-------KHPACLPFDDGEQHESFIAIGWGQ 206
            .|..|..||.:|..: .||:.|::|...|:.:.:       :..|.:.:.|     :.|.:||||
  Fly   119 SVDRLVVHPEYERYK-KNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGD-----TCITLGWGQ 177

  Fly   207 KKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAY 271
            .......|.:|:      |.|..:.......:..:.:.....:|.........|.||.|||:|  
  Fly   178 IYQHGPYSNELV------YLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLL-- 234

  Fly   272 HKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWI 310
                 |...:.|:....:.|:... ...:....|:.:||
  Fly   235 -----CKGALFGLIGGHMGCAGGK-AMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 57/234 (24%)
Tryp_SPc 72..310 CDD:214473 55/232 (24%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 53/214 (25%)
Tryp_SPc 59..250 CDD:238113 53/214 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437198
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.