DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG3700

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:277 Identity:110/277 - (39%)
Similarity:150/277 - (54%) Gaps:35/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 YETVDSCHGSRPLIVDGTPAEPKEFPFAARLG-HR--KTNNEIKWFCGGTLISNRLVLTAAHCFF 120
            |..|.|...|.|.||.||.|..|||||.|.:| ||  |:.::|.|.|||:::..:.|||||||..
  Fly    89 YNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLE 153

  Fly   121 SEHGEVN-----------VVRLGELEFDTDTDDAEPEDFGVLALKAHPGF----ENPQLYNDIGI 170
            ::..:..           |||||||::::.||||..:||.|:....|||:    |.....|||.:
  Fly   154 TDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIAL 218

  Fly   171 VQLDREVKFNRYKHPACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKD-----RCV 230
            |:|||:.:||.:....|||.|.|...:...|.|||......| |..||||.||.:.|     |..
  Fly   219 VELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVK-SSHLLKVNLQRFSDEVCQKRLR 282

  Fly   231 SSVDANDELPNGYEPKSQLCIGSRDNK-DTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTP 294
            .|:|.          ::|.|.||..:: ||||||||||:...|....|:..|:||.|.|:.|.:.
  Fly   283 FSIDT----------RTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQ 337

  Fly   295 DIPSAYTRVHYFLNWIK 311
            .:||.||:||.:.:||:
  Fly   338 GLPSVYTKVHLYTDWIE 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 104/262 (40%)
Tryp_SPc 72..310 CDD:214473 103/261 (39%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 105/264 (40%)
Tryp_SPc 102..353 CDD:214473 103/261 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 1 1.000 - - FOG0012717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.