DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG13527

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:241 Identity:55/241 - (22%)
Similarity:92/241 - (38%) Gaps:67/241 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 FCGGTLISNRLVLTAAHCFFSEHGEVNVVRL--------GELEFDTDTDDAEPEDFGVLALKAHP 157
            :|||.|:||:.|:|||||...:...:...|.        ..|.:........|    |.:|....
  Fly    61 YCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSP----VSSLYVPK 121

  Fly   158 GFENPQLYNDIGIVQLDREVKFN----RYKHPACLPFDD---GEQHESFIAIGWGQKKFAQKESK 215
            .|.....:| :.:::|..::..|    .:.|   ||.:.   |.:|   ..:|||:..|....:.
  Fly   122 NFTMHNTFN-MALMKLQEKMPSNDPRIGFLH---LPKEAPKIGIRH---TVLGWGRMYFGGPLAV 179

  Fly   216 KLLKVQL------------QGYKDRCVSSVDANDELPNGYEPKSQLCIGSRD---NKDTCNGDSG 265
            .:.:|.:            :.|.|                   ..:|.|:.:   :.:.|:||.|
  Fly   180 HIYQVDVVLMDNAVCKTYFRHYGD-------------------GMMCAGNNNWTIDAEPCSGDIG 225

  Fly   266 GPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIK 311
            .|:|:...       |:||.:..|.|...:|||.||.|...|.||:
  Fly   226 SPLLSGKV-------VVGIVAYPIGCGCTNIPSVYTDVFSGLRWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 54/239 (23%)
Tryp_SPc 72..310 CDD:214473 53/238 (22%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 55/241 (23%)
Tryp_SPc 43..263 CDD:214473 53/238 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.