DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG30283

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:312 Identity:90/312 - (28%)
Similarity:135/312 - (43%) Gaps:66/312 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILLLVFSLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRPLIV 73
            :::::.:.||.:|.|.....|.:..|         ..|.||.|                   .|:
  Fly     8 VVVVLLAASSVVVLGSESGSFLEHPC---------GTVPISQF-------------------KIL 44

  Fly    74 DGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDT 138
            .|..|.....|:.|.:     ..|..:.||||||:||.|||:|||.  .:||:. ||||.||   
  Fly    45 GGHNAPVASAPWMAMV-----MGEGGFHCGGTLITNRFVLTSAHCI--ANGELK-VRLGVLE--- 98

  Fly   139 DTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDD-----GEQHES 198
              .:||.:.|.|.|:..|..:...|  :|:.:::|.:.|.::....|.||..|.     .|....
  Fly    99 --REAEAQKFAVDAMFVHTDYYFDQ--HDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVK 159

  Fly   199 FIAIGWGQKKFAQKESKKLLKVQLQG-YKDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNG 262
            |...||| |..::..|:.|.|..|.. ::..|..      :.|:....::.:|..|. |.:||||
  Fly   160 FRTYGWG-KTESRSSSRMLQKTSLFNLHRSECAK------QYPHQQINRNHICAESA-NANTCNG 216

  Fly   263 DSGGP---VLAYHKDLACMYHVMGITSAG-ITCSTPDIPSAYTRVHYFLNWI 310
            |||||   ::.|  |...|....|:||.| ..||...:   :|.|...|:||
  Fly   217 DSGGPLTAIVTY--DHVQMVFQFGVTSFGHADCSKATV---FTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 80/249 (32%)
Tryp_SPc 72..310 CDD:214473 78/247 (32%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 78/248 (31%)
Tryp_SPc 43..266 CDD:238113 80/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.