DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and scaf

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:278 Identity:65/278 - (23%)
Similarity:103/278 - (37%) Gaps:74/278 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVN----- 127
            ::|..|....|...|.|:.|.:....:...|   |||.:|.::.||::|.|       ||     
  Fly   419 TKPTGVKDLDANFAEIPWQAMILRESSKTLI---CGGAIIGDQFVLSSASC-------VNGLPVT 473

  Fly   128 --VVRLGELEFDTDTDDAEPEDF---GVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPAC 187
              .|:.||.|..:..   ||..|   ||..:..||.::.....:|:.|::|:|.::|..:..|.|
  Fly   474 DIRVKAGEWELGSTN---EPLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPIC 535

  Fly   188 LPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYE----PKSQ 248
            :..:|.:..|.....|||::..:..|...|:.|               .|.||....    ..|.
  Fly   536 ISDEDPKDSEQCFTSGWGKQALSIHEEGALMHV---------------TDTLPQARSECSADSSS 585

  Fly   249 LCIGSRDNKDTCNGDSGGPVLAYHKDLAC----MYHVMGITSAGITC--------STPDIPSAYT 301
            :|  |....|:|..|.|..       |||    ...:.||.:...:|        :.|||     
  Fly   586 VC--SATKFDSCQFDVGSA-------LACGSGSSVRLKGIFAGENSCGEGQTVRFAKPDI----- 636

  Fly   302 RVHYFLNWIKGELAKQTQ 319
                  .||....|:..:
  Fly   637 ------KWINTAFAENNK 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 62/264 (23%)
Tryp_SPc 72..310 CDD:214473 61/263 (23%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 54/224 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.