DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG17572

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:307 Identity:78/307 - (25%)
Similarity:131/307 - (42%) Gaps:65/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ITYETVDSC-HGSRPLIVDGT---------PAEPKE--------------------FPFAARLGH 91
            :.||...|| :|.:.|...|:         |:.|.|                    :||.||:|.
  Fly    84 LIYEVARSCYYGDKSLYCGGSSEELPYVCCPSSPLEKNQVCGKSLVQGHFYKGLGSYPFVARIGF 148

  Fly    92 RKTN-NEIKWFCGGTLISNRLVLTAAHCFFSE---HGEVNVVRLGELEFDTDTDDAE-----PE- 146
            :..| ....:.|.|.:|:.|::||||||..::   | .::.||:||.:..:|.|.|.     |. 
  Fly   149 KHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGH-RLSSVRVGEYDTSSDPDCANTGFCAPRS 212

  Fly   147 -DFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQHESFIAI-------G 203
             :..:..:..||.::..|.::||.::.|...:.::....|.||     ::..:.:.:       |
  Fly   213 VNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICL-----QKTRANLVVGKRATIAG 272

  Fly   204 WGQKKFAQKESKKL--LKVQLQGYKDRCVSSVDAND--ELPNGYEPKSQLCIGSRDNKDTCNGDS 264
            ||:...:.....::  |.|.|..: |.|:.:..:..  |.||..|.: .:|.|. :.||.|.|..
  Fly   273 WGKMSTSSVRQPEMSHLDVPLTSW-DLCLRNYGSTGALESPNSIEGQ-WMCAGG-EGKDVCQGFG 334

  Fly   265 GGPVLAYHKDLACMYHVMGITSAGI-TCSTPDIPSAYTRVHYFLNWI 310
            |.|:......:   :..:||.|.|. .|....|||.||.|.:|..||
  Fly   335 GAPLFIQENGI---FSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 72/291 (25%)
Tryp_SPc 72..310 CDD:214473 70/289 (24%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 68/253 (27%)
Tryp_SPc 138..378 CDD:214473 66/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.