DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG4650

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:290 Identity:74/290 - (25%)
Similarity:119/290 - (41%) Gaps:40/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNR 110
            ::...|....|.:.:.:|   |...|:.:|..|.....|:.|.| |   .:|:.:.||||:|:.:
  Fly     8 ISALLFLLPVPGSSQYLD---GRCGLLTNGKIANNISSPWMAYL-H---TSELLYVCGGTVITEK 65

  Fly   111 LVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDR 175
            ||||||||  :...|..|.|:||.....|.:|....::.|.....|..:......|||.|:.|..
  Fly    66 LVLTAAHC--TRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLAT 128

  Fly   176 EVKFNRYKHPACL-------PFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSV 233
            ::.|::...|.|:       .:.|..|..|  ...||... .:.||.......::.......|::
  Fly   129 DIVFSKTIRPICIVWWTIWRKYIDNIQVLS--GAQWGLPN-DRNESDAFRITDIRRQPANMCSTL 190

  Fly   234 DANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPV--LAYHKDLACMYHVMGITSAGITCSTPDI 296
            :....|      .||.|.|..|:| .||.|...|:  :...|::. .|.::||.:....|..   
  Fly   191 NGTAIL------SSQFCAGDSDSK-LCNVDFSSPLGAIITFKNIQ-RYVLIGIATTNQKCKR--- 244

  Fly   297 PSAYTRVHYFLNWI--------KGELAKQT 318
            .|.||.|....::|        .||.:.:|
  Fly   245 ASVYTDVLSHTDFILSVWRQYRNGEKSPKT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 66/255 (26%)
Tryp_SPc 72..310 CDD:214473 65/246 (26%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 65/244 (27%)
Tryp_SPc 33..258 CDD:304450 65/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.