DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:280 Identity:80/280 - (28%)
Similarity:125/280 - (44%) Gaps:56/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 APITYETVDSCHGS--------RPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRL 111
            |.::.|||...|..        ...||:|.||...:.|:...||......   |:|||::|::..
  Fly    12 AAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGG---WWCGGSIIAHDW 73

  Fly   112 VLTAAHCFFSEHGEVNVVRLGELEFDTD---TDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQL 173
            |||||||   .:|...|.......:.|:   |......||    ::.| .:.| |..|||.:::.
  Fly    74 VLTAAHC---TNGASQVTIYYGATWRTNAQFTHTVGSGDF----IQNH-NWPN-QNGNDIALIRT 129

  Fly   174 DREVKF----NRYKHPACLPFDDG-EQHESF--IAIGWGQKKFAQKESKKLLKVQLQGYKDRCVS 231
            . .|.|    |:.:.|:   |:|. ..::::  :|.|||           |.....|.....||.
  Fly   130 P-HVDFWHMVNKVELPS---FNDRYNMYDNYWAVACGWG-----------LTTAGSQPDWMECVD 179

  Fly   232 -SVDANDELPNGY--EPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITS--AGITC 291
             .:.:|.|....|  :|...||:.:...|.||:||||||::.:...     .::|:||  :|..|
  Fly   180 LQIISNSECSRTYGTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGG-----RLVGVTSWVSGNGC 239

  Fly   292 STPDIPSAYTRVHYFLNWIK 311
             |..:||.:|||...|:||:
  Fly   240 -TAGLPSGFTRVTNQLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 74/253 (29%)
Tryp_SPc 72..310 CDD:214473 73/252 (29%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 73/253 (29%)
Tryp_SPc 37..260 CDD:238113 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.