DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and sphe

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:262 Identity:60/262 - (22%)
Similarity:108/262 - (41%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEV 126
            |..|| ::..|:.|..|:.....|.|.|  |..|..:   |||:::|...:||.|||...:...:
  Fly    17 VGMCH-AQGRIMGGEDADATATTFTASL--RVDNAHV---CGGSILSQTKILTTAHCVHRDGKLI 75

  Fly   127 NVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFN-------RYKH 184
            :..||. ....:....|..:...|.::..||.:.|  |.|::.::.|..|:.:.       ....
  Fly    76 DASRLA-CRVGSTNQYAGGKIVNVESVAVHPDYYN--LNNNLAVITLSSELTYTDRITAIPLVAS 137

  Fly   185 PACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQ-GYKDRCVSSVDANDELPNGYEPKSQ 248
            ...||.:..|    .|..|||:.... ..|.|:.::.|: ..:..|:.:...:||        ..
  Fly   138 GEALPAEGSE----VIVAGWGRTSDG-TNSYKIRQISLKVAPEATCLDAYSDHDE--------QS 189

  Fly   249 LCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIKGE 313
            .|:.....:.||:||.||..: |...|      :|:|:..:.......|..:.|:..:.:||:.:
  Fly   190 FCLAHELKEGTCHGDGGGGAI-YGNTL------IGLTNFVVGACGSRYPDVFVRLSSYADWIQEQ 247

  Fly   314 LA 315
            :|
  Fly   248 IA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 55/246 (22%)
Tryp_SPc 72..310 CDD:214473 54/245 (22%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 51/232 (22%)
Tryp_SPc 42..244 CDD:214473 49/229 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.