DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG31220

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:267 Identity:78/267 - (29%)
Similarity:117/267 - (43%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARLGHR-----KTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRL 131
            ::.||.....|:|:.|.|.:|     ..:.|:...|||:||:.|.|||||||......::..|||
  Fly   104 VIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQRVRL 168

  Fly   132 GELEFDTDTDDAEPE---------------DFGVLALKAHPGFE--NPQLYNDIGIVQLDREVKF 179
            ||     .|....|:               |..|.::.:|..::  |....|||.:|:|...|::
  Fly   169 GE-----HTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLKEPVRY 228

  Fly   180 NRYKHPAC-LPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGY 243
            ....:|.| |.:............|||:.......||.|....::..|....|...|:    ..:
  Fly   229 TMAYYPICVLDYPRSLMKFKMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEECSEKYAH----RHF 289

  Fly   244 EPKSQLCIGSRDNKDTCNGDSGGPVLAYH-KDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFL 307
            .|:.|:|.|..||:.||:||||.|::... :....:..:.||||.|..|.|...||.:||...|.
  Fly   290 GPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCGTIGWPSVFTRTAKFY 354

  Fly   308 NWIKGEL 314
            .||:..|
  Fly   355 KWIRAHL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 76/262 (29%)
Tryp_SPc 72..310 CDD:214473 75/261 (29%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 75/261 (29%)
Tryp_SPc 104..360 CDD:238113 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.