DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and sphinx1

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:268 Identity:59/268 - (22%)
Similarity:97/268 - (36%) Gaps:71/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGEL 134
            |.|..|..|:.....:...:.:.|:......:..||:|||:.:||........:.||::.     
  Fly    24 PRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYIEVHLA----- 83

  Fly   135 EFDTDTDDAEPEDFGVLALKAHPGFENPQLY---------ND--IGIVQLDREVKFNRYKHPACL 188
                             :.:::.||:..::|         ||  |.:|:...: ||:|......:
  Fly    84 -----------------SRRSYRGFDIIRIYKENFRFHYDNDHVIALVKCPYQ-KFDRRMDRVRV 130

  Fly   189 PFDDGEQHESFI-----AIGWGQKKFAQKESKKLLKVQLQGYKDRCVS-SVDANDELPNGYEPKS 247
            |..| .:.|.::     ..|:|.:|...|..:.:          ||:. .|..|.|....|.|..
  Fly   131 PAYD-TRFERYVGNMTMVCGYGTEKRHAKLPEWM----------RCIEVEVMNNTECAKYYTPLK 184

  Fly   248 --QLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMG--ITSAGITCSTPD-----IPSAYTRV 303
              ::|......|..|.||.||.|:           .||  .|..||....|:     .||.:.||
  Fly   185 WYEMCTSGEGFKGVCEGDIGGAVV-----------TMGPNPTFIGIIWLMPENCSIGYPSVHIRV 238

  Fly   304 HYFLNWIK 311
            ...:.|||
  Fly   239 SDHIKWIK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 56/264 (21%)
Tryp_SPc 72..310 CDD:214473 55/263 (21%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 55/264 (21%)
Tryp_SPc 26..248 CDD:304450 58/266 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.