DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and spirit

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:297 Identity:96/297 - (32%)
Similarity:137/297 - (46%) Gaps:56/297 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKT 94
            :|.||.:..::  .:...|..||..                 :|.|.|..|:||||.|.||.|..
  Fly   109 SQQACNELNKV--SKVKEIDEFFVS-----------------VVGGMPTRPREFPFMAALGWRSN 154

  Fly    95 -NNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPG 158
             :..|.:.|||.||:|..|||||||........:.||||    ..:....|.||..:..:..||.
  Fly   155 FDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLG----GDNLTLTEGEDISIRRVIIHPD 215

  Fly   159 FENPQLYNDIGIVQLDR----EVKFNRYKHPACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLK 219
            :.....||||.:::|:.    |:|      |.|:.......:....|||:||..||...|.:|||
  Fly   216 YSASTAYNDIALLELETAAKPELK------PTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLK 274

  Fly   220 VQLQGYKDRCVSSVDANDELPNGYEPK--------SQLCIGS-RDNKDTCNGDSGGPVLAYHKDL 275
            |.|:..         :|:|..:.|:..        :|:|.|. ...:|||.||||||:|...   
  Fly   275 VPLKSV---------SNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQD--- 327

  Fly   276 ACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIKG 312
            ..:.:|:||||.|..|::.. ||.||||..|::||:|
  Fly   328 GLLGYVVGITSLGQGCASGP-PSVYTRVSSFVDWIEG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 88/252 (35%)
Tryp_SPc 72..310 CDD:214473 87/251 (35%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 90/255 (35%)
Tryp_SPc 132..361 CDD:214473 87/251 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.