DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG11664

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:268 Identity:55/268 - (20%)
Similarity:89/268 - (33%) Gaps:98/268 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GTPAEPKEFPFAARL-GHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDT 138
            |.|.:.:.:.:..:: |.       ::...|:|.|.|.|||.||||                   
  Fly    26 GIPVQQQNYGYVMQIYGP-------QFLAAGSLFSARYVLTVAHCF------------------- 64

  Fly   139 DTDDAEPEDFGVLA----------------LKAHPGFENPQLYNDIGIVQLDREVK--------- 178
             ..:.:||:..|.|                |..||.|....|.|||.::::...:.         
  Fly    65 -KKNTKPEELSVRAGYRWIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIG 128

  Fly   179 --------FNRYKHPACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDA 235
                    .|.:..|..|             .||.....||  ..|.:.||::..|: |      
  Fly   129 LCSRPLTPLNMFAPPQEL-------------AGWNLMHIAQ--PLKSMSVQVEPEKN-C------ 171

  Fly   236 NDELPNGYEPK---SQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIP 297
                 ..:.|:   ..:|..:...:..|.||||.|:::..:       |.|:..|...|.....|
  Fly   172 -----RQWFPQISGGVICASATMGEGLCYGDSGDPLISGGE-------VCGLAIAFRKCGDKRYP 224

  Fly   298 SAYTRVHY 305
            :.:|.|||
  Fly   225 ALFTDVHY 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 55/268 (21%)
Tryp_SPc 72..310 CDD:214473 55/268 (21%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 53/256 (21%)
Tryp_SPc 38..237 CDD:214473 53/256 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.