DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and GZMK

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:298 Identity:83/298 - (27%)
Similarity:114/298 - (38%) Gaps:59/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFPFAARL---GHRKTNN 96
            |||...      ::.|....|.:|:    .|....  |:.|....|...||.|.:   ||.    
Human     2 TKFSSF------SLFFLIVGAYMTH----VCFNME--IIGGKEVSPHSRPFMASIQYGGHH---- 50

  Fly    97 EIKWFCGGTLISNRLVLTAAHCFFS-EHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGF- 159
                .|||.||..:.|||||||.:. ..|:...|.||  ......::|..:   .|.:|....| 
Human    51 ----VCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLG--AHSLSKNEASKQ---TLEIKKFIPFS 106

  Fly   160 ---ENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQHESFI---AIGWG-QKKFAQKESKKL 217
               .:|| .|||.:|:|....|.|  ||...|.........|..   ..||| ....:.:.|..|
Human   107 RVTSDPQ-SNDIMLVKLQTAAKLN--KHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTL 168

  Fly   218 LKVQLQGYKDRCVSSVDANDELPNG--YEPKSQLCIG-SRDNKDTCNGDSGGPVLAYHKDLAC-- 277
            .:|.:.....:..:|    ....||  :..|..:|.| ::..||:|.||||||       |.|  
Human   169 REVTVTVLSRKLCNS----QSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGP-------LICKG 222

  Fly   278 MYHVMGITSAGITCSTPDIPSAYTRV-HYFLNWIKGEL 314
            ::|  .|.|.|..|.....|..||.: ..:..|||..|
Human   223 VFH--AIVSGGHECGVATKPGIYTLLTKKYQTWIKSNL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 73/256 (29%)
Tryp_SPc 72..310 CDD:214473 72/255 (28%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 72/258 (28%)
Tryp_SPc 27..257 CDD:238113 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.